DPCfam | MC208504
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 169 ± 26 aa |
| Residues in low-complexity regions (%) | 1.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08473 |
| Sequences matching dominant architecture (%) | 94.81 |
| Average overlap percent | 29.75 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005EF1041 | 256-434 | 179 | MNVNVSDYFVGDHWRVHPSWVYCRYHYLEGHEFNSSKDELLHFLGLMSRPGWRWSEQYEAYPSIDEDKEPNCGRQTLKHDDYYCN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0B4K866-F1 | 734-933 | 99.40 | 72.49 | View in AlphaFoldDB ↗ |