DPCfam | MC208410
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 430 ± 37 aa |
| Residues in low-complexity regions (%) | 1.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.03 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF13676 |
| Sequences matching dominant architecture (%) | 77.5 |
| Average overlap percent | 30.49 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S3KYB0 | 7-446 | 440 | PKVFISYSWTVQDWVVEFAQRLVNAGIDTIVDFWNLKPGNDKYKFMESMVTDNTIDFVLIVCDKTYAEKANDRTGEVGDETVIIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2W4FM13-F1 | 15-172 | 37.02 | 87.92 | View in AlphaFoldDB ↗ |