DPCfam | MC208363
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Residues in low-complexity regions (%) | 1.16 |
| Residues in coiled-coil regions (%) | 7.96 |
| Predicted disordered residues (%) | 20.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02262 |
| Sequences matching dominant architecture (%) | 96.88 |
| Average overlap percent | 74.98 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7IS05 | 46-163 | 118 | GIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P22681-F1 | 50-146 | 97.98 | 93.92 | View in AlphaFoldDB ↗ |