DPCfam | MC207670
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 86 ± 11 aa |
| Residues in low-complexity regions (%) | 0.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13304 |
| Sequences matching dominant architecture (%) | 90.7 |
| Average overlap percent | 25.11 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7KJS0 | 122-206 | 85 | NEDSEYSRSVYDGISSWQIYHFHDTSSTAGMRHYQIVQDDEKLRFDGSNVAPYLLRLKNRHPDEYREILDALGLVMPFFDDFILE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EW88-F1 | 143-227 | 94.19 | 95.06 | View in AlphaFoldDB ↗ |