DPCfam | MC207547
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Residues in low-complexity regions (%) | 1.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.04 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF01946 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.99 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S8FEA1 | 190-246 | 57 | MDVEPAEQGVVERACEVHPGLYVTGMSVCATFRLPRMGPIFGGMLKSGRRTADLIVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O59082-F1 | 188-251 | 98.46 | 97.78 | View in AlphaFoldDB ↗ |