DPCfam | MC207498
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Residues in low-complexity regions (%) | 1.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.01 |
| Average transmembrane regions | 0.29 |
| Dominant Pfam architecture(s) | PF01841 |
| Sequences matching dominant architecture (%) | 2.38 |
| Average overlap percent | 72.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000718FE7D | 132-191 | 60 | PTTLRSPTWLINFRRGNSFECATFLTSLLLGQGYNAFVVFGYASREQVQCDRTRITCPYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0V9S9-F1 | 153-214 | 98.41 | 92.96 | View in AlphaFoldDB ↗ |