DPCfam | MC20738
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00535 |
| Sequences matching dominant architecture (%) | 4.17 |
| Average overlap percent | 42.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7XBD6 | 418-491 | 74 | RIAHLEFFIDALGVLHVGSCNDVIVSHTSKIKLPWGQSETDKAYAKFREPSTTTQVAQDRLFYFKNRLQCLTYK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7EXK5-F1 | 410-479 | 98.61 | 91.90 | View in AlphaFoldDB ↗ |