DPCfam | MC207328
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 246 ± 31 aa |
| Residues in low-complexity regions (%) | 4.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02729 |
| Sequences matching dominant architecture (%) | 66.67 |
| Average overlap percent | 15.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M2XXT9 | 2101-2375 | 275 | LLASVQEGRLGISWVESRLVDNPRRILGLSPSIGTFVEVNLDTCWTEQNSSSPFYGQMCRGVVQRTVIHNEIVYLDGKMLCKGQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U3JAV8-F1 | 1720-1981 | 100.00 | 64.83 | View in AlphaFoldDB ↗ |