DPCfam | MC207224
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08766 |
| Sequences matching dominant architecture (%) | 2.22 |
| Average overlap percent | 59.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A135V4L0 | 1-64 | 64 | MAPSDKEIEASILAKVREVFKTDIDNLNVNSVRRRVESDLNLEDDVLSSGKWKDKSKKLIKELA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NAX0-F1 | 16-82 | 97.06 | 92.93 | View in AlphaFoldDB ↗ |