DPCfam | MC207160
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 275 ± 28 aa |
| Residues in low-complexity regions (%) | 1.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13699 |
| Sequences matching dominant architecture (%) | 4.55 |
| Average overlap percent | 15.36 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0TPM2 | 29-317 | 289 | SDSIAFLNRVDAAKVLTQEDDFVRGISQFDMASRMKREDSPTKSEYLAFVAEQTLDWTPQERAAVTQAFNQLQPKLSALKVGLPT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6GNS2-F1 | 89-142 | 17.89 | 96.87 | View in AlphaFoldDB ↗ |