DPCfam | MC207143
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Residues in low-complexity regions (%) | 1.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16291 |
| Sequences matching dominant architecture (%) | 98.04 |
| Average overlap percent | 87.77 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V2Q2G7 | 10-102 | 93 | VLAKWITCDVPIDARDAFAATQRRWSVIADQPGLVGQVGGWDSRTSRAHVLALWADTDSHGVFLRDRHDAVADAGGYTGISVALG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P96598-F1 | 1-96 | 94.95 | 91.77 | View in AlphaFoldDB ↗ |