DPCfam | MC206873
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Residues in low-complexity regions (%) | 2.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.71 |
| Average transmembrane regions | 0.47 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067JLR6 | 757-884 | 127 | NVHHRGCPMLLQAWALDKLSLIPPVPARLIPTYGPAHFRPRSRGHFDFGDKPVIRWTCPWWRIRMVTAGTMNLSYVLYSSLNRSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0WWV4-F1 | 15-45 | 23.48 | 41.41 | View in AlphaFoldDB ↗ |