DPCfam | MC20675
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 179 ± 23 aa |
| Residues in low-complexity regions (%) | 12.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.44 |
| Average transmembrane regions | 0.27 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004C0D60D | 4-202 | 198 | KRFIAGVATLASVGLVGGIASQAMADSSTPAAITAEDGRALYAGAFFLQGETGKDLAGSPYFNGSATVLKENNTAKAKAAVAKVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34344-F1 | 13-191 | 93.62 | 72.41 | View in AlphaFoldDB ↗ |