DPCfam | MC20646
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 139 ± 17 aa |
| Residues in low-complexity regions (%) | 2.88 |
| Residues in coiled-coil regions (%) | 7.8 |
| Predicted disordered residues (%) | 21.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04121 |
| Sequences matching dominant architecture (%) | 97.56 |
| Average overlap percent | 19.05 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A093R1Z3 | 144-275 | 132 | TMSMYSDFLHSFLKHTSTTIFDLVDEYESICNSQVNILGKIVYRATPGQQKFSKTASVLWLLKQEMVTWRLLSSLYRDRIQSALE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BH74-F1 | 146-276 | 100.00 | 87.56 | View in AlphaFoldDB ↗ |