DPCfam | MC206438
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Residues in low-complexity regions (%) | 3.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.86 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02424 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 15.96 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B0H6X6 | 19-91 | 73 | MLAVVSLFLLASCSSERQAIKLSGSTMGTGWSVKYWSDETLPDKMQVQQSIQSQLNSFEQMMSTYRADSDITQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F6X3-F1 | 15-92 | 98.63 | 85.75 | View in AlphaFoldDB ↗ |