DPCfam | MC206280
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 185 ± 23 aa |
| Residues in low-complexity regions (%) | 8.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 46.51 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF18149 |
| Sequences matching dominant architecture (%) | 1.2 |
| Average overlap percent | 10.27 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A196S824 | 1-217 | 217 | MAERAIQERQYAYVNNSSQISQADKRSYGGRNEPNGMAESLAGRTLPRMGDRAVLVSDEVKKLHERKEQKKREKATTETYEQKRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VUV9-F1 | 6-185 | 96.88 | 68.20 | View in AlphaFoldDB ↗ |