DPCfam | MC206183
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Residues in low-complexity regions (%) | 0.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00017 |
| Sequences matching dominant architecture (%) | 87.5 |
| Average overlap percent | 25.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7V840 | 636-705 | 70 | DKQTFHLAPWGKHDLTIRSFADRLHDLHHLIFLYPNRLKDEVFGPYYTPQRVEARNDGYLESQVTITMPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q68SP3-F1 | 640-708 | 98.59 | 89.57 | View in AlphaFoldDB ↗ |