DPCfam | MC206057
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 194 ± 16 aa |
| Residues in low-complexity regions (%) | 2.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01568 |
| Sequences matching dominant architecture (%) | 13.33 |
| Average overlap percent | 31.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6D2S2 | 696-899 | 204 | RIRGQKLSRSPIRSSGRTAMRANISVHEPRQPVDKDTMFAFSMEGNNSPTANRQQIPFAWAPGWNSPQAWNKFQNEVGGHLRHGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0A1Y4-F1 | 702-891 | 99.48 | 92.88 | View in AlphaFoldDB ↗ |