DPCfam | MC205807
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09865 |
| Sequences matching dominant architecture (%) | 5.88 |
| Average overlap percent | 83.96 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S8GX56 | 192-304 | 113 | ISEAILEQVKQVDLQLMVTELMKMEYIELGSKTIDGVVAEGIEFIDPKFGVYLFDNGTGELWVDPLSNLPVLLIAEGDTNDGTRH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58100-F1 | 126-201 | 90.91 | 93.51 | View in AlphaFoldDB ↗ |