DPCfam | MC205632
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 180 ± 16 aa |
| Residues in low-complexity regions (%) | 3.31 |
| Residues in coiled-coil regions (%) | 23.25 |
| Predicted disordered residues (%) | 27.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2H9G9 | 931-1111 | 181 | CGHDLQDHRHLTYDLRERTVIEGAEEVAKRLQDGHDTIKPVRELVKEKTRRVEQFKEEQKLIQEACSQFSFFMKKNSITPYNDAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GUA8-F1 | 978-1147 | 97.14 | 75.94 | View in AlphaFoldDB ↗ |