DPCfam | MC205010
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 428 ± 27 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.61 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF13489 |
| Sequences matching dominant architecture (%) | 5.93 |
| Average overlap percent | 22.91 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L7WAS8 | 10-454 | 445 | DPSGFMYKENGLYYRWINPVFFIEYNQAKSEGIYQKLFDKGWLIPHKEISSSDDKIIIQPEQLGFITYPYEWSFTQYKHAAQLTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q52892-F1 | 25-456 | 99.76 | 91.26 | View in AlphaFoldDB ↗ |