DPCfam | MC204970
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Residues in low-complexity regions (%) | 2.65 |
| Residues in coiled-coil regions (%) | 0.28 |
| Predicted disordered residues (%) | 43.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M0P834 | 1154-1224 | 70 | TSKSQRDRIKNIKGLIADIEDEYEEGAPVEEVLDRAGEIGMDPGKAEQEIEKLRTKGEVYEPKQGHLRTT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57809-F1 | 686-756 | 95.89 | 85.18 | View in AlphaFoldDB ↗ |