DPCfam | MC20495
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 419 ± 64 aa |
| Residues in low-complexity regions (%) | 4.08 |
| Residues in coiled-coil regions (%) | 2.4 |
| Predicted disordered residues (%) | 18.19 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF13229 |
| Sequences matching dominant architecture (%) | 61.02 |
| Average overlap percent | 23.27 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2N4F5 | 157-574 | 418 | WLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPFSSNIANIPRDLVDEILEELEHSVPLLEVYPVEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4INR7-F1 | 146-596 | 99.77 | 82.43 | View in AlphaFoldDB ↗ |