DPCfam | MC204907
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 581 |
|---|---|
| Mean domain length (aa) | 224 ± 32 aa |
| Residues in low-complexity regions (%) | 14.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.14 |
| Average transmembrane regions | 4.11 |
| Dominant Pfam architecture(s) | PF01940 |
| Sequences matching dominant architecture (%) | 98.61 |
| Average overlap percent | 91.9 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q6ZWB6 | 44-249 | 206 | FGWHGLVVLFAFFLSGSLLTQVAERRAPRRTARQVIANGGVAAVAALLGAWWVATGALAAAAADTWATELGAFSPFAPRLITTGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0WP96-F1 | 23-270 | 99.58 | 96.37 | View in AlphaFoldDB ↗ |