DPCfam | MC204781
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 507 ± 31 aa |
| Residues in low-complexity regions (%) | 2.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.27 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF17132 |
| Sequences matching dominant architecture (%) | 99.12 |
| Average overlap percent | 59.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D1QQ61 | 1-501 | 501 | MSKKILRNYLLKMFLTVCLFFATQNAQAQETSLYRSFVNPPAVARPHLWWHWMNGNITKDGIYKDLMWMHRIGIGGFHHFDAGLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-T2KNA8-F1 | 201-381 | 35.90 | 97.31 | View in AlphaFoldDB ↗ |