DPCfam | MC204655
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Residues in low-complexity regions (%) | 3.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.72 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D5PNZ9 | 45-147 | 103 | AGTARGFYFNTVLSLARSLAVQSPAPLEKVQKLLCMCPVDFHGIFQLDERRRDAVIALGIFLIESDLQHKDNVVPYLLRLLKGLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M9PDM4-F1 | 10-97 | 93.62 | 86.44 | View in AlphaFoldDB ↗ |