DPCfam | MC204633
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 547 ± 50 aa |
| Residues in low-complexity regions (%) | 2.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13086 |
| Sequences matching dominant architecture (%) | 34.02 |
| Average overlap percent | 11.76 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V3ZXB9 | 277-818 | 542 | HLDNIKFDQLRQWNFRQPKWTLSIFTMCDKHTNGRLCSFSNKPDHLNYCPEAHSQLEIQEWETRKRWREMNKQLSDEVDKCIKMQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VUH9-F1 | 281-874 | 100.00 | 72.65 | View in AlphaFoldDB ↗ |