DPCfam | MC204228
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Residues in low-complexity regions (%) | 6.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.32 |
| Average transmembrane regions | 1.38 |
| Dominant Pfam architecture(s) | PF01569 |
| Sequences matching dominant architecture (%) | 2.08 |
| Average overlap percent | 51.75 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6GM05 | 8-81 | 74 | TIMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSDIPPVLLLSLVTGVPVLVIIVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7TMB0-F1 | 9-89 | 98.78 | 81.44 | View in AlphaFoldDB ↗ |