DPCfam | MC204089
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 248 ± 25 aa |
| Residues in low-complexity regions (%) | 7.29 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 7.34 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006B0CFC7 | 879-1089 | 211 | VCVGLLNLLENVVLTIPDSLVSQVLGNIVRPDILIVLAHHKSGYLRSTVVKVISAYLQRAFDEQINGFLKMKGFHLLANQLHQYS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9QFZ1-F1 | 1103-1345 | 98.80 | 81.76 | View in AlphaFoldDB ↗ |