DPCfam | MC204058
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 204 ± 34 aa |
| Residues in low-complexity regions (%) | 2.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00169 |
| Sequences matching dominant architecture (%) | 91.84 |
| Average overlap percent | 48.62 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A087UUW3 | 4-187 | 184 | HKFAKDNTATSWTPGYFLLKAGVLYCMDDEKSKPNFDIPLCTPHCQGCRRIHLLDRPYAFEIIRSNSASLQLAAADTVEASKWLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IWE5-F1 | 771-976 | 94.52 | 84.41 | View in AlphaFoldDB ↗ |