DPCfam | MC204008
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 232 ± 25 aa |
| Residues in low-complexity regions (%) | 1.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04962 |
| Sequences matching dominant architecture (%) | 98.71 |
| Average overlap percent | 90.76 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U2WD61 | 18-260 | 243 | TEDHDLKYVAFGKISLTEGEDYSSQTGGYETALVLLTGKVTVACENEKWTDLGERNNVFKGKATAVYIPCQSGYQVTAQSNDVQI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5KYR2-F1 | 26-261 | 99.57 | 98.18 | View in AlphaFoldDB ↗ |