DPCfam | MC203633
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Residues in low-complexity regions (%) | 0.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.28 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF07992 |
| Sequences matching dominant architecture (%) | 17.74 |
| Average overlap percent | 19.23 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0EGL6 | 785-881 | 97 | DYLQLDSRFFITSGLIDIDKEIFNIIHENGLVYNGRLIVKSNFQTTQENIFACGKICEFSQRYKHHSVGKSLRLDKYNGRELGQK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F8W3A6-F1 | 227-314 | 97.78 | 93.77 | View in AlphaFoldDB ↗ |