DPCfam | MC203440
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 257 ± 38 aa |
| Residues in low-complexity regions (%) | 3.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00145 |
| Sequences matching dominant architecture (%) | 91.84 |
| Average overlap percent | 8.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9DBI6 | 99-333 | 235 | RDPTSNGALVLKPGCGVELEDHSFLTITETITSSSSTRYIRGHRLLLQNHCELLMPERHHELVQLVNIDKELNTEVALWTVPIDA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NHN8-F1 | 118-352 | 98.78 | 86.70 | View in AlphaFoldDB ↗ |