DPCfam | MC20333
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17404 |
| Sequences matching dominant architecture (%) | 96.15 |
| Average overlap percent | 79.09 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D4B278 | 459-597 | 139 | SITLPGRRPPTIQAAERLQSLHRVLTKALGDRATAIDLTSGEVPSWAVKSTSPPKESKKWTIIAGLNLDASNQGRSIDHGPSVED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1HDT4-F1 | 478-600 | 98.39 | 89.77 | View in AlphaFoldDB ↗ |