DPCfam | MC203187
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 514 ± 57 aa |
| Residues in low-complexity regions (%) | 4.01 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 16.82 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF05664 |
| Sequences matching dominant architecture (%) | 80.0 |
| Average overlap percent | 81.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178V6F5 | 29-519 | 491 | SIRQVASKLSSLPGRCGIEEETYYWTAIYHLNIRLYEKLLFGVFDTLDEGQVIEDASSMLFHMKSIWSTLGITENLHSAIYGWVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A368ULH4-F1 | 145-692 | 100.00 | 88.10 | View in AlphaFoldDB ↗ |