DPCfam | MC203173
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1401 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Residues in low-complexity regions (%) | 1.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00630 |
| Sequences matching dominant architecture (%) | 71.2 |
| Average overlap percent | 83.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007623F4D | 84-178 | 95 | GLEGGVTGNPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0JPT7-F1 | 1067-1155 | 98.88 | 78.23 | View in AlphaFoldDB ↗ |