DPCfam | MC203094
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 205 ± 27 aa |
| Residues in low-complexity regions (%) | 4.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12070 |
| Sequences matching dominant architecture (%) | 87.67 |
| Average overlap percent | 47.62 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A199UGX1 | 273-487 | 215 | EVKIGELTLDTFRMLQCLEWDPCGMFSLKSGADGTHSGMGLNSHNLLQDIRDPSLPLNPRKLILYRPSITHFLMVLATMCEELPH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8N9R8-F1 | 273-459 | 100.00 | 84.23 | View in AlphaFoldDB ↗ |