DPCfam | MC202849
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 236 ± 31 aa |
| Residues in low-complexity regions (%) | 3.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.2 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF16507 |
| Sequences matching dominant architecture (%) | 96.86 |
| Average overlap percent | 51.88 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151ZER2 | 561-771 | 211 | VSKQSEDSKKREIPPGMFLQETLELFFSQMSDEIYTTILDNLVRYFTKTFEPDYYKQFGMVLKSAVLRDPKQAISKFLPVIQGKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R2X6-F1 | 557-782 | 99.12 | 92.01 | View in AlphaFoldDB ↗ |