DPCfam | MC202723
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 139 ± 13 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08706 |
| Sequences matching dominant architecture (%) | 6.38 |
| Average overlap percent | 8.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W0QCR9 | 5-132 | 128 | QNAPNVSKQPKGKPYEAYIIAGSNAWDKTKQQTVLEWTKAEPNYQPIILGSKQLQEIDRLKLAVEVGNVAIYRAGTLTEAEKSAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GWD8-F1 | 3-135 | 97.18 | 87.48 | View in AlphaFoldDB ↗ |