DPCfam | MC202704
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 672 ± 118 aa |
| Residues in low-complexity regions (%) | 12.28 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 62.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02535 |
| Sequences matching dominant architecture (%) | 2.5 |
| Average overlap percent | 0.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q17MM1 | 336-977 | 642 | ASSVAKFTLHSSSLPKPQYPVPISLPSAAPRYVMDPKGAKQAANVSRKGSLNQFQRELSSERSYDLDFHPSNPDSDTTSNNRMPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M9PEP9-F1 | 206-1039 | 99.40 | 39.50 | View in AlphaFoldDB ↗ |