DPCfam | MC20219
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Residues in low-complexity regions (%) | 0.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00148 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 24.63 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5LQJ3 | 252-327 | 76 | GTVILDDTNPAELEKFMVEKGADILVGGVKERPLAYKLGIAFCDHNHERKHPLCGFEGAINFAKEIDISINSPVWK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P26506-F1 | 372-459 | 100.00 | 87.82 | View in AlphaFoldDB ↗ |