DPCfam | MC201878
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 362 ± 42 aa |
| Residues in low-complexity regions (%) | 12.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 79.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H6C8S0 | 1086-1448 | 363 | ANDSDSDSSFRKRRRRKSATPGQHAMRRSMRGAAEPTLRDTGHDHLRSQSPEPRRPFSPTMGARSMRTSMRGSMDSGVPTLRAAP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GV93-F1 | 1135-1484 | 99.15 | 46.03 | View in AlphaFoldDB ↗ |