DPCfam | MC20184
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 286 ± 59 aa |
| Residues in low-complexity regions (%) | 2.81 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 11.36 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF16206 |
| Sequences matching dominant architecture (%) | 43.0 |
| Average overlap percent | 67.54 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166CCB1 | 1036-1253 | 218 | LGGSNERGYSALIKSAFQSLTLVCDALSVLSPDHLRLCISTLGAFGRQADTNIALTAAESLFWGVSDAIQAARRTPSSEPAYSAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F4K5S0-F1 | 833-1145 | 98.51 | 76.09 | View in AlphaFoldDB ↗ |