DPCfam | MC201276
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Residues in low-complexity regions (%) | 2.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04869 |
| Sequences matching dominant architecture (%) | 97.67 |
| Average overlap percent | 49.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S4P7M1 | 114-227 | 114 | MSMVNEKQPFPLRCAVLYCFQCYLSHNEMSQANLVQTLLPSSSDVSSLTSGQILCGGLFSTDVLSNWFSAVALMHALVDNTTQKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O60763-F1 | 370-482 | 99.12 | 93.20 | View in AlphaFoldDB ↗ |