DPCfam | MC201224
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Residues in low-complexity regions (%) | 1.2 |
| Residues in coiled-coil regions (%) | 1.13 |
| Predicted disordered residues (%) | 11.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M7N5U2 | 87-169 | 83 | KEEYYKQHLNFNRLFLNYLSSFRTFIDHSETTIKRKFGKTSDQADMFKKITNGLFDEFFSYRFLCKLRNYSQHCGLPIDEIEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8CZ38-F1 | 107-179 | 97.33 | 95.01 | View in AlphaFoldDB ↗ |