DPCfam | MC201147
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Residues in low-complexity regions (%) | 1.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.31 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF18084 |
| Sequences matching dominant architecture (%) | 5.41 |
| Average overlap percent | 17.99 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L8GFU2 | 413-504 | 92 | NFLISLVIYIRSRIANCSNYCPICDHKHECEGLKPIVCAKPDCVWRYEELGLGANVNAEIARAPEVVDLMISLACAGVNSGRGET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WE52-F1 | 399-480 | 94.25 | 81.35 | View in AlphaFoldDB ↗ |