DPCfam | MC200994
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 276 ± 31 aa |
| Residues in low-complexity regions (%) | 3.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.89 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09952 |
| Sequences matching dominant architecture (%) | 63.02 |
| Average overlap percent | 51.15 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X8DVJ3 | 31-348 | 318 | FRMTLTTDDGAAVDFLAEVKLSTNRLPVQDITRQLRAMASAFGDAPLLYVSEYVSPPLRRELDEANISYLDTTGWVSLTASDPPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I6Y4Y1-F1 | 65-334 | 94.30 | 86.45 | View in AlphaFoldDB ↗ |