DPCfam | MC200789
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03211 |
| Sequences matching dominant architecture (%) | 99.18 |
| Average overlap percent | 38.49 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B7XUN1 | 137-198 | 62 | EKRASFPIPASKGTVTYKAAQKVSGTFDGGLKTYGRGVKCTGQAEGGDKDAVFILANGATLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W8J9-F1 | 23-91 | 94.52 | 97.57 | View in AlphaFoldDB ↗ |