DPCfam | MC20076
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 97 ± 27 aa |
| Residues in low-complexity regions (%) | 18.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 45.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02178 |
| Sequences matching dominant architecture (%) | 1.79 |
| Average overlap percent | 3.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004E597AE | 1-129 | 129 | MATEHIPVVDLRLLSQAEINTLSIACPNAFDLHRCDDVVVPKIDRSVFNESAGSRKQTYSRLRLAPRKPDAPPSSASSSSSVARR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7KJ99-F1 | 15-120 | 97.27 | 61.43 | View in AlphaFoldDB ↗ |