DPCfam | MC200546
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 163 ± 12 aa |
| Residues in low-complexity regions (%) | 4.62 |
| Residues in coiled-coil regions (%) | 3.67 |
| Predicted disordered residues (%) | 20.98 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00056833B3 | 5-170 | 166 | LPAVNQKLYFCGLLLQQTDRELTCVVGPAANLQLALCQSALFQLEVAYRLYLREVATTYRHRAAESISSVEGLIAAMESIGQSPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZJ6-F1 | 6-171 | 98.80 | 89.22 | View in AlphaFoldDB ↗ |